CD38 Recombinant Protein

Catalogue Number: NCP0322-500, NCP0322-1000

Sizes: 500ug, 1mg

Swiss-Prot: P28907

Host: E.coli

Tag: His-tag

AA Sequence: VPRWRQQWSGPGTTKRFPEt VLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNIT
EEDYQPLMKLGTQt VPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGE
FNTSKINYQSCPDWRKDCSNNPVSVFWKt VSRRFAEAACDVVHVMLNGSRSKIFDKNSTF
GSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPD
KFLQCVKNPEDSSCTSEI

Restriction Sites: NdeI-XhoI

Background: Cyclic ADP-ribose hydrolase 1 (CD38) is a transmembrane protein involved in several important biological processes, including immune response, insulin secretion, and social behavior. Originally described as a glycosylated immune cell surface marker, additional research determined that CD38 is a multifunctional enzyme that catalyzes the synthesis and hydrolysis of cyclic ADP ribose (cADPR) from NAD. Under acidic conditions, CD38 also catalyzes the synthesis of nicotinic acid adenine dinucleotide phosphate (NAADP) from NADP+. Both cADPR and NAADP act as calcium ion mobilizing messengers that target different intracellular Ca2+ stores. Since CD38 is the primary mammalian NAD+ glycohydrolase responsible for NAD+ metabolism, CD38 may be a valuable therapeutic target for treatment of metabolic diseases regulated by NAD+-dependent pathways. CD38 has also been considered a possible therapeutic target for antibody-mediated therapy for myeloma and chronic lymphocytic leukemia.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~36kDa

Notes: For research use only, not for use in diagnostic procedure.