20% OFF shipping at www.randa.lt on orders over $79 + up to 10% OFF products
www.randa.lt
home > CD305 Recombinant Protein - NCP0330 > CD305 Recombinant Protein - NCP0330
download picture
CD305 Recombinant Protein - NCP0330CD305 Recombinant Protein Catalogue Number: NCP0330 500, NCP0330 1000 Sizes: 500ug, 1mg Swiss Prot: Q6GTX8 Host: E. coli Tag: His tag AA Sequence: QEEDLPRPSISAEPGt VIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY Restriction Sites: NdeI XhoI Background: LAIR 1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig like
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

CD305 Recombinant Protein

Catalogue Number: NCP0330-500, NCP0330-1000

Sizes: 500ug, 1mg

Swiss-Prot: Q6GTX8

Host: E.coli

Tag: His-tag

AA Sequence: QEEDLPRPSISAEPGt VIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE
SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT
QRPSDNSHNEHAPASQGLKAEHLY

Restriction Sites: NdeI-XhoI

Background: LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.

Soluble: PBS, 4M Urea, PH7.4

Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Expression Vector: pet-22b(+)

BioWorld Molecular Weight: ~20kDa

Notes: For research use only, not for use in diagnostic procedure.

CD305 Recombinant Protein - NCP0330

Item no : 9051147388
sold recently : Login >>
US$ 525.41
Pay in 4 interest-free payments of $131.35 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jun 25 - Jun 30

Enjoy 20% off shipping

US$ 525.41

1-11

US$ 472.87

12-35

US$ 367.79

36-59

US$ 315.25

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches