Shopping security
CD305 Recombinant Protein
Catalogue Number: NCP0330-500, NCP0330-1000
Sizes: 500ug, 1mg
Swiss-Prot: Q6GTX8
Host: E.coli
Tag: His-tag
AA Sequence: QEEDLPRPSISAEPGt VIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE
SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT
QRPSDNSHNEHAPASQGLKAEHLY
Restriction Sites: NdeI-XhoI
Background: LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue.
Soluble: PBS, 4M Urea, PH7.4
Purification and Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression Vector: pet-22b(+)
BioWorld Molecular Weight: ~20kDa
Notes: For research use only, not for use in diagnostic procedure.
Ships within 48 hours · Estimated delivery Jun 25 - Jun 30
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Top-Converting Item to Boost Your Average Order